PlantTFDB
Plant Transcription Factor Database
v4.0
Previous version: v3.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID PGSC0003DMP400021259
Common NameLOC102579526
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; eudicotyledons; Gunneridae; Pentapetalae; asterids; lamiids; Solanales; Solanaceae; Solanoideae; Solaneae; Solanum
Family GATA
Protein Properties Length: 266aa    MW: 29237.6 Da    PI: 5.4342
Description GATA family protein
Gene Model
Gene Model ID Type Source Coding Sequence
PGSC0003DMP400021259genomePGSCView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1GATA58.68e-19189223135
                  GATA   1 CsnCgttkTplWRrgpdgnktLCnaCGlyyrkkgl 35 
                           Cs+Cg+ kTplWR gp g+ktLCnaCG+++++ +l
  PGSC0003DMP400021259 189 CSHCGVQKTPLWRTGPLGEKTLCNACGVRFKSGRL 223
                           *******************************9986 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
PIRSFPIRSF0169922.8E-721262IPR016679Transcription factor, GATA, plant
SMARTSM004013.4E-15183233IPR000679Zinc finger, GATA-type
PROSITE profilePS5011412.308186219IPR000679Zinc finger, GATA-type
Gene3DG3DSA:3.30.50.103.3E-15187221IPR013088Zinc finger, NHR/GATA-type
SuperFamilySSF577161.9E-14188246No hitNo description
CDDcd002021.50E-16188238No hitNo description
PROSITE patternPS003440189214IPR000679Zinc finger, GATA-type
PfamPF003201.6E-16189223IPR000679Zinc finger, GATA-type
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0045893Biological Processpositive regulation of transcription, DNA-templated
GO:0005634Cellular Componentnucleus
GO:0003700Molecular Functiontranscription factor activity, sequence-specific DNA binding
GO:0008270Molecular Functionzinc ion binding
GO:0043565Molecular Functionsequence-specific DNA binding
Sequence ? help Back to Top
Protein Sequence    Length: 266 aa     Download sequence    Send to blast
MDYSGNCQSF VSGDDLFVDE LLDLSSGFPD DEGNQNENES KYSSSPQIKE SDKETVIIPS  60
VKQDFGSLLG SELSLPGADL DNLEWLSHFV EDSFSEYSLT YSAGNLPEKA LEVHSDAEIP  120
VPEKPCFTVP FSAEREKSSS RIWPPSMSFS SSSSTTANNF WGQLSENKPA ARKLKKKMEK  180
RVGIGAKQCS HCGVQKTPLW RTGPLGEKTL CNACGVRFKS GRLLPEYRPA SSPTFSTGLH  240
SNSHRKVLEM RQKKETEPGP PVQSF*
Regulation -- PlantRegMap ? help Back to Top
Source Upstream Regulator Target Gene
PlantRegMapRetrieve-
Annotation -- Nucleotide ? help Back to Top
Source Hit ID E-value Description
GenBankHG9754410.0HG975441.1 Solanum pennellii chromosome ch02, complete genome.
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_006347003.10.0PREDICTED: GATA transcription factor 5-like
SwissprotQ9FH571e-56GATA5_ARATH; GATA transcription factor 5
TrEMBLM1AVJ60.0M1AVJ6_SOLTU; Uncharacterized protein
STRINGPGSC0003DMT4000313560.0(Solanum tuberosum)
Orthologous Group ? help Back to Top
LineageOrthologous Group IDTaxa NumberGene Number
AsteridsOGEA11542481
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT5G66320.22e-47GATA transcription factor 5
Publications ? help Back to Top
  1. Xu X, et al.
    Genome sequence and analysis of the tuber crop potato.
    Nature, 2011. 475(7355): p. 189-95
    [PMID:21743474]